SCOPe 2.01: Domain d1skye1: 1sky E:357-470

Lineage for d1skye1 (1sky E:357-470)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)

7. Species Bacillus sp., strain ps3 [TaxId:1409] [88931] (1 PDB entry)

8. Domain d1skye1: 1sky E:357-470 [18314]
   Other proteins in same PDB: d1skyb1, d1skyb2, d1skyb3, d1skye2, d1skye3
   complexed with so4

Details for d1skye1

PDB Entry: 1sky, 3.2 Å

PDB Description: crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-atpase from the thermophilic bacillus ps3

PDB Compounds: (E:) f1-ATPase

SCOPe Domain Sequences for d1skye1:

Sequence; same for both SEQRES and ATOM records:

>d1skye1 a.69.1.1 (E:357-470) F1 ATP synthase beta subunit, domain 3 {Bacillus sp., strain ps3 [TaxId: 1409]}
eivgeehyqvarkvqqtlerykelqdiiailgmdelsdedklvvhrarriqfflsqnfhv
aeqftgqpgsyvpvketvrgfkeilegkydhlpedrfrlvgrieevvekakamg

Timeline for d1skye1:

• d1skye1 first appeared (with stable ids) in SCOP 1.55
  
• d1skye1 appears in SCOP 1.75
  
• d1skye1 appears in SCOPe 2.02
  
• d1skye1 appears in the current release, SCOPe 2.08