Lineage for d1skye1 (1sky E:357-470)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215201Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 215202Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 215203Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 215204Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)
  7. 215205Species Bacillus sp., strain ps3 [TaxId:1409] [47922] (1 PDB entry)
  8. 215207Domain d1skye1: 1sky E:357-470 [18314]
    Other proteins in same PDB: d1skyb2, d1skyb3, d1skye2, d1skye3
    complexed with so4

Details for d1skye1

PDB Entry: 1sky (more details)

PDB Description: crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-atpase from the thermophilic bacillus ps3

SCOP Domain Sequences for d1skye1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skye1 a.69.1.1 (E:357-470) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Bacillus sp., strain ps3}
eivgeehyqvarkvqqtlerykelqdiiailgmdelsdedklvvhrarriqfflsqnfhv
aeqftgqpgsyvpvketvrgfkeilegkydhlpedrfrlvgrieevvekakamg

SCOP Domain Coordinates for d1skye1:

Click to download the PDB-style file with coordinates for d1skye1.
(The format of our PDB-style files is described here.)

Timeline for d1skye1: