Class a: All alpha proteins [46456] (284 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species) |
Species Bacillus sp., strain ps3 [TaxId:1409] [88926] (1 PDB entry) |
Domain d1skyb1: 1sky B:372-502 [18313] Other proteins in same PDB: d1skyb2, d1skyb3, d1skye1, d1skye2, d1skye3 complexed with so4 |
PDB Entry: 1sky (more details), 3.2 Å
SCOPe Domain Sequences for d1skyb1:
Sequence, based on SEQRES records: (download)
>d1skyb1 a.69.1.1 (B:372-502) F1 ATP synthase alpha subunit, domain 3 {Bacillus sp., strain ps3 [TaxId: 1409]} ikamkkvagtlrldlaayreleafaqfgsdldkatqanvargartvevlkqdlhqpipve kqvliiyaltrgflddipvedvrrfekefylwldqngqhllehirttkdlpneddlnqai eafkktfvvsq
>d1skyb1 a.69.1.1 (B:372-502) F1 ATP synthase alpha subunit, domain 3 {Bacillus sp., strain ps3 [TaxId: 1409]} ikamkkvagtlrldlaayrelefaqfsddkatqanvargartvevlkqdlhqpipvekqv liiyaltrgflddipvedvrrfekefylwldqngqhllehirttkdlpneddlnqaieaf kktfvvsq
Timeline for d1skyb1: