SCOPe 2.08: Domain d3okjl_: 3okj L:

Lineage for d3okjl_ (3okj L:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3okjl_: 3okj L: [183089]
   Other proteins in same PDB: d3okja_, d3okjb_, d3okjc_, d3okje_, d3okjf_, d3okjg_, d3okjo_, d3okjp_, d3okjq_, d3okjs_, d3okjt_, d3okju_
   automated match to d1g0ul_
   complexed with ep9

Details for d3okjl_

PDB Entry: 3okj, 2.7 Å

PDB Description: alpha-keto-aldehyde binding mechanism reveals a novel lead structure motif for proteasome inhibition

PDB Compounds: (L:) Proteasome component C5

SCOPe Domain Sequences for d3okjl_:

Sequence; same for both SEQRES and ATOM records:

>d3okjl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

Timeline for d3okjl_:

• d3okjl_ first appeared in SCOPe 2.01
  
• d3okjl_ appears in SCOPe 2.07