Lineage for d3okjg_ (3okj G:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552712Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2552819Domain d3okjg_: 3okj G: [183084]
    Other proteins in same PDB: d3okj1_, d3okj2_, d3okja_, d3okjb_, d3okjc_, d3okjd_, d3okje_, d3okjf_, d3okjh_, d3okji_, d3okjj_, d3okjk_, d3okjl_, d3okjm_, d3okjn_, d3okjo_, d3okjp_, d3okjq_, d3okjr_, d3okjs_, d3okjt_, d3okjv_, d3okjw_, d3okjx_, d3okjy_, d3okjz_
    automated match to d1g65g_
    complexed with ep9

Details for d3okjg_

PDB Entry: 3okj (more details), 2.7 Å

PDB Description: alpha-keto-aldehyde binding mechanism reveals a novel lead structure motif for proteasome inhibition
PDB Compounds: (G:) Proteasome component C7-alpha

SCOPe Domain Sequences for d3okjg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3okjg_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d3okjg_:

Click to download the PDB-style file with coordinates for d3okjg_.
(The format of our PDB-style files is described here.)

Timeline for d3okjg_: