SCOPe 2.01: Domain d1cowd1: 1cow D:358-475

Lineage for d1cowd1 (1cow D:358-475)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88929] (12 PDB entries)
   Uniprot P00829

8. Domain d1cowd1: 1cow D:358-475 [18308]
   Other proteins in same PDB: d1cowa1, d1cowa2, d1cowa3, d1cowb1, d1cowb2, d1cowb3, d1cowc1, d1cowc2, d1cowc3, d1cowd2, d1cowd3, d1cowe2, d1cowe3, d1cowf2, d1cowf3, d1cowg_
   complexed with adp, anp, aur, mg

Details for d1cowd1

PDB Entry: 1cow, 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with aurovertin b

PDB Compounds: (D:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1cowd1:

Sequence; same for both SEQRES and ATOM records:

>d1cowd1 a.69.1.1 (D:358-475) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklae

Timeline for d1cowd1:

• d1cowd1 first appeared (with stable ids) in SCOP 1.55
  
• d1cowd1 appears in SCOP 1.75
  
• d1cowd1 appears in SCOPe 2.02
  
• d1cowd1 appears in the current release, SCOPe 2.08