SCOPe 2.08: Domain d3okj1_: 3okj 1:

Lineage for d3okj1_ (3okj 1:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3okj1_: 3okj 1: [183077]
   Other proteins in same PDB: d3okja_, d3okjb_, d3okjc_, d3okje_, d3okjf_, d3okjg_, d3okjo_, d3okjp_, d3okjq_, d3okjs_, d3okjt_, d3okju_
   automated match to d1g0u1_
   complexed with ep9

Details for d3okj1_

PDB Entry: 3okj, 2.7 Å

PDB Description: alpha-keto-aldehyde binding mechanism reveals a novel lead structure motif for proteasome inhibition

PDB Compounds: (1:) Proteasome component PRE4

SCOPe Domain Sequences for d3okj1_:

Sequence; same for both SEQRES and ATOM records:

>d3okj1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

Timeline for d3okj1_:

• d3okj1_ first appeared in SCOPe 2.01
  
• d3okj1_ appears in SCOPe 2.07