SCOPe 2.01: Domain d3okic_: 3oki C:

Lineage for d3okic_ (3oki C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (97 PDB entries)

8. Domain d3okic_: 3oki C: [183076]
   automated match to d1osha_
   protein/DNA complex; complexed with oki

Details for d3okic_

PDB Entry: 3oki, 2 Å

PDB Description: Crystal structure of human FXR in complex with (2S)-2-[2-(4-chlorophenyl)-1H-benzimidazol-1-yl]-N,2-dicyclohexylethanamide

PDB Compounds: (C:) Bile acid receptor

SCOPe Domain Sequences for d3okic_:

Sequence; same for both SEQRES and ATOM records:

>d3okic_ a.123.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveft
kklpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdllearirnsgisdeyi
tpmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckih
qpenpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdvq

Timeline for d3okic_:

• d3okic_ is new in SCOPe 2.01-stable
  
• d3okic_ appears in SCOPe 2.02
  
• d3okic_ appears in the current release, SCOPe 2.08, called d3okic1