Lineage for d3okha_ (3okh A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923994Protein automated matches [190059] (10 species)
    not a true protein
  7. 924007Species Human (Homo sapiens) [TaxId:9606] [187214] (97 PDB entries)
  8. 924136Domain d3okha_: 3okh A: [183074]
    automated match to d1osha_
    protein/DNA complex; complexed with okh

Details for d3okha_

PDB Entry: 3okh (more details), 2.5 Å

PDB Description: Crystal structure of human FXR in complex with 2-(4-chlorophenyl)-1-[(1S)-1-cyclohexyl-2-(cyclohexylamino)-2-oxoethyl]-1H-benzimidazole-6-carboxylic acid
PDB Compounds: (A:) Bile acid receptor

SCOPe Domain Sequences for d3okha_:

Sequence, based on SEQRES records: (download)

>d3okha_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdllearirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
penpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv

Sequence, based on observed residues (ATOM records): (download)

>d3okha_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltpdqqtllhfimdsynkqrmpqeitnkilkeafsaeenfliltematnhvqvlveftk
klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdllearirnsgisdeyit
pmfsfyksigelkmtqeeyalltaivilspdryikdreaveklqeplldvlqklckihqp
enpqhfacllgrltelrtfnhhhaemlmswrvndhkftpllceiwdv

SCOPe Domain Coordinates for d3okha_:

Click to download the PDB-style file with coordinates for d3okha_.
(The format of our PDB-style files is described here.)

Timeline for d3okha_: