SCOPe 2.03: Domain d3oiwa_: 3oiw A:

Lineage for d3oiwa_ (3oiw A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein cH-p21 Ras protein [52593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52594] (100 PDB entries)
   Uniprot Q6P716

8. Domain d3oiwa_: 3oiw A: [183059]
   automated match to d121pa_
   complexed with act, ca, gnp, mg

Details for d3oiwa_

PDB Entry: 3oiw, 1.3 Å

PDB Description: h-rasg12v with allosteric switch in the "on" state

PDB Compounds: (A:) gtpase hras

SCOPe Domain Sequences for d3oiwa_:

Sequence; same for both SEQRES and ATOM records:

>d3oiwa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d3oiwa_:

• d3oiwa_ first appeared in SCOPe 2.01
  
• d3oiwa_ appears in SCOPe 2.02
  
• d3oiwa_ appears in SCOPe 2.04
  
• d3oiwa_ appears in the current release, SCOPe 2.08