Lineage for d1cowa1 (1cow A:380-510)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330430Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2330431Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2330432Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2330433Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species)
  7. 2330452Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries)
    Uniprot P19483
  8. 2330495Domain d1cowa1: 1cow A:380-510 [18305]
    Other proteins in same PDB: d1cowa2, d1cowa3, d1cowb2, d1cowb3, d1cowc2, d1cowc3, d1cowd1, d1cowd2, d1cowd3, d1cowe1, d1cowe2, d1cowe3, d1cowf1, d1cowf2, d1cowf3, d1cowg_
    complexed with adp, anp, aur, mg

Details for d1cowa1

PDB Entry: 1cow (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with aurovertin b
PDB Compounds: (A:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1cowa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cowa1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOPe Domain Coordinates for d1cowa1:

Click to download the PDB-style file with coordinates for d1cowa1.
(The format of our PDB-style files is described here.)

Timeline for d1cowa1: