SCOPe 2.06: Domain d3ohuf_: 3ohu F:

Lineage for d3ohuf_ (3ohu F:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (39 PDB entries)

8. Domain d3ohuf_: 3ohu F: [183040]
   Other proteins in same PDB: d3ohua2
   automated match to d1r28a_

Details for d3ohuf_

PDB Entry: 3ohu, 2.1 Å

PDB Description: Crystal structure of the human Bach2 POZ domain, form I

PDB Compounds: (F:) Transcription regulator protein BACH2

SCOPe Domain Sequences for d3ohuf_:

Sequence; same for both SEQRES and ATOM records:

>d3ohuf_ d.42.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwqalvgqtk
ndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnledscfsfl

Timeline for d3ohuf_:

• d3ohuf_ first appeared in SCOPe 2.01
  
• d3ohuf_ appears in SCOPe 2.05
  
• d3ohuf_ appears in SCOPe 2.07
  
• d3ohuf_ appears in the current release, SCOPe 2.08