SCOPe 2.07: Domain d1efrf1: 1efr F:358-474

Lineage for d1efrf1 (1efr F:358-474)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries)
   Uniprot P00829

8. Domain d1efrf1: 1efr F:358-474 [18304]
   Other proteins in same PDB: d1efra1, d1efra2, d1efra3, d1efrb1, d1efrb2, d1efrb3, d1efrc1, d1efrc2, d1efrc3, d1efrd2, d1efrd3, d1efre2, d1efre3, d1efrf2, d1efrf3, d1efrg_
   complexed with adp, anp, mg

Details for d1efrf1

PDB Entry: 1efr, 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

PDB Compounds: (F:) bovine mitochondrial f1-ATPase subunit beta

SCOPe Domain Sequences for d1efrf1:

Sequence; same for both SEQRES and ATOM records:

>d1efrf1 a.69.1.1 (F:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

Timeline for d1efrf1:

• d1efrf1 first appeared (with stable ids) in SCOP 1.55
  
• d1efrf1 appears in SCOPe 2.06
  
• d1efrf1 appears in the current release, SCOPe 2.08