SCOPe 2.08: Domain d3ohua1: 3ohu A:9-129

Lineage for d3ohua1 (3ohu A:9-129)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)

8. Domain d3ohua1: 3ohu A:9-129 [183035]
   Other proteins in same PDB: d3ohua2
   automated match to d1r28a_

Details for d3ohua1

PDB Entry: 3ohu, 2.1 Å

PDB Description: Crystal structure of the human Bach2 POZ domain, form I

PDB Compounds: (A:) Transcription regulator protein BACH2

SCOPe Domain Sequences for d3ohua1:

Sequence; same for both SEQRES and ATOM records:

>d3ohua1 d.42.1.0 (A:9-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spmyvyestvhctnillglndqrkkdilcdvtliverkefrahravlaacseyfwqalvg
qtkndlvvslpeevtargfgpllqfaytaklllsrenirevircaeflrmhnledscfsf
l

Timeline for d3ohua1:

• d3ohua1 first appeared in SCOPe 2.01, called d3ohua_
  
• d3ohua1 appears in SCOPe 2.07