Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein Green fluorescent protein, GFP [54513] (4 species) |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (160 PDB entries) Uniprot P42212 |
Domain d3ogoc_: 3ogo C: [183013] Other proteins in same PDB: d3ogoe_, d3ogof_, d3ogog_, d3ogoh_ automated match to d1qyoa_ complexed with ipa |
PDB Entry: 3ogo (more details), 2.8 Å
SCOPe Domain Sequences for d3ogoc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ogoc_ d.22.1.1 (C:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]} skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv ttlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh yqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagitl
Timeline for d3ogoc_: