Lineage for d3og9b_ (3og9 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1004084Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1004085Protein automated matches [190543] (18 species)
    not a true protein
  7. 1004129Species Lactococcus lactis [TaxId:272623] [189573] (1 PDB entry)
  8. 1004131Domain d3og9b_: 3og9 B: [183009]
    automated match to d2h1ia1
    complexed with mlt

Details for d3og9b_

PDB Entry: 3og9 (more details), 1.88 Å

PDB Description: Structure of YahD with Malic acid
PDB Compounds: (B:) protein yahD a copper inducible hydrolase

SCOPe Domain Sequences for d3og9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3og9b_ c.69.1.0 (B:) automated matches {Lactococcus lactis [TaxId: 272623]}
mtdyvfkagrkdlapllllhstggdehqlveiaemiapshpilsirgrineqgvnryfkl
rglggftkenfdlesldeetdwltdevsllaekhdldvhkmiaigysnganvalnmflrg
kinfdkiiafhgmqledfeqtvqlddkhvflsyapndmivpqknfgdlkgdledsgcqle
iyesslghqltqeevlaakkwltetk

SCOPe Domain Coordinates for d3og9b_:

Click to download the PDB-style file with coordinates for d3og9b_.
(The format of our PDB-style files is described here.)

Timeline for d3og9b_: