SCOPe 2.08: Domain d3og9b_: 3og9 B:

Lineage for d3og9b_ (3og9 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:272623] [189573] (1 PDB entry)

8. Domain d3og9b_: 3og9 B: [183009]
   automated match to d2h1ia1
   complexed with mlt

Details for d3og9b_

PDB Entry: 3og9, 1.88 Å

PDB Description: Structure of YahD with Malic acid

PDB Compounds: (B:) protein yahD a copper inducible hydrolase

SCOPe Domain Sequences for d3og9b_:

Sequence; same for both SEQRES and ATOM records:

>d3og9b_ c.69.1.0 (B:) automated matches {Lactococcus lactis [TaxId: 272623]}
mtdyvfkagrkdlapllllhstggdehqlveiaemiapshpilsirgrineqgvnryfkl
rglggftkenfdlesldeetdwltdevsllaekhdldvhkmiaigysnganvalnmflrg
kinfdkiiafhgmqledfeqtvqlddkhvflsyapndmivpqknfgdlkgdledsgcqle
iyesslghqltqeevlaakkwltetk

Timeline for d3og9b_:

• d3og9b_ first appeared in SCOPe 2.01
  
• d3og9b_ appears in SCOPe 2.07