SCOP 1.59: Domain d1efrb1: 1efr B:380-510

Lineage for d1efrb1 (1efr B:380-510)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.69: Left-handed superhelix [47916] (3 superfamilies)

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)

6. Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)

8. Domain d1efrb1: 1efr B:380-510 [18300]
   Other proteins in same PDB: d1efra2, d1efra3, d1efrb2, d1efrb3, d1efrc2, d1efrc3, d1efrd2, d1efrd3, d1efre2, d1efre3, d1efrf2, d1efrf3, d1efrg_

Details for d1efrb1

PDB Entry: 1efr, 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

SCOP Domain Sequences for d1efrb1:

Sequence; same for both SEQRES and ATOM records:

>d1efrb1 a.69.1.1 (B:380-510) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

Timeline for d1efrb1:

• d1efrb1 first appeared (with stable ids) in SCOP 1.55
  
• d1efrb1 appears in SCOP 1.57
  
• d1efrb1 appears in SCOP 1.61
  
• d1efrb1 appears in the current release, SCOPe 2.08