Class a: All alpha proteins [46456] (151 folds) |
Fold a.69: Left-handed superhelix [47916] (3 superfamilies) |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein) |
Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries) |
Domain d1efrb1: 1efr B:380-510 [18300] Other proteins in same PDB: d1efra2, d1efra3, d1efrb2, d1efrb3, d1efrc2, d1efrc3, d1efrd2, d1efrd3, d1efre2, d1efre3, d1efrf2, d1efrf3, d1efrg_ |
PDB Entry: 1efr (more details), 3.1 Å
SCOP Domain Sequences for d1efrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efrb1 a.69.1.1 (B:380-510) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke ivtnflagfea
Timeline for d1efrb1: