SCOPe 2.08: Domain d3ofse_: 3ofs E:

Lineage for d3ofse_ (3ofs E:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
   contains extra N-terminal all-alpha subdomain
   automatically mapped to Pfam PF02267

6. Protein ADP ribosyl cyclase [56631] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159490] (46 PDB entries)
   Uniprot P28907 45-291

8. Domain d3ofse_: 3ofs E: [182998]
   automated match to d2ef1a1
   complexed with avu

Details for d3ofse_

PDB Entry: 3ofs, 2.2 Å

PDB Description: dynamic conformations of the cd38-mediated nad cyclization captured using multi-copy crystallography

PDB Compounds: (E:) ADP-ribosyl cyclase 1

SCOPe Domain Sequences for d3ofse_:

Sequence; same for both SEQRES and ATOM records:

>d3ofse_ c.23.14.3 (E:) ADP ribosyl cyclase {Human (Homo sapiens) [TaxId: 9606]}
wrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcditeed
yqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftladtllgyladdltwcgefdt
skinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmldgsrskifdkdstfgsv
evhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrp

Timeline for d3ofse_:

• d3ofse_ first appeared in SCOPe 2.01
  
• d3ofse_ appears in SCOPe 2.07