SCOP 1.63: Domain d1e1qd1: 1e1q D:358-475

Lineage for d1e1qd1 (1e1q D:358-475)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)

6. Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)

8. Domain d1e1qd1: 1e1q D:358-475 [18296]
   Other proteins in same PDB: d1e1qa2, d1e1qa3, d1e1qb2, d1e1qb3, d1e1qc2, d1e1qc3, d1e1qd2, d1e1qd3, d1e1qe2, d1e1qe3, d1e1qf2, d1e1qf3, d1e1qg_

Details for d1e1qd1

PDB Entry: 1e1q, 2.61 Å

PDB Description: bovine mitochondrial f1-atpase at 100k

SCOP Domain Sequences for d1e1qd1:

Sequence; same for both SEQRES and ATOM records:

>d1e1qd1 a.69.1.1 (D:358-475) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklae

Timeline for d1e1qd1:

• d1e1qd1 first appeared (with stable ids) in SCOP 1.55
  
• d1e1qd1 appears in SCOP 1.61
  
• d1e1qd1 appears in SCOP 1.65
  
• d1e1qd1 appears in the current release, SCOPe 2.08