Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold |
Family c.49.2.0: automated matches [191450] (1 protein) not a true family |
Protein automated matches [190687] (2 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187815] (6 PDB entries) |
Domain d3oeeg_: 3oee G: [182956] Other proteins in same PDB: d3oeed1, d3oeed2, d3oeed3, d3oeee1, d3oeee2, d3oeee3, d3oeef1, d3oeef2, d3oeef3, d3oeem1, d3oeem2, d3oeem3, d3oeen1, d3oeen2, d3oeen3, d3oeeo1, d3oeeo2, d3oeeo3, d3oeev1, d3oeev2, d3oeev3, d3oeew1, d3oeew2, d3oeew3, d3oeex1, d3oeex2, d3oeex3 automated match to d1bmfg_ complexed with anp, mg, po4; mutant |
PDB Entry: 3oee (more details), 2.74 Å
SCOPe Domain Sequences for d3oeeg_:
Sequence, based on SEQRES records: (download)
>d3oeeg_ c.49.2.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna sknagdminrysilynrtrqavitnelvdiitgass
>d3oeeg_ c.49.2.0 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl kelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsi ngigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieq spsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminr ysilynrtrqavitnelvdiitgass
Timeline for d3oeeg_:
View in 3D Domains from other chains: (mouse over for more information) d3oeed1, d3oeed2, d3oeed3, d3oeee1, d3oeee2, d3oeee3, d3oeef1, d3oeef2, d3oeef3, d3oeem1, d3oeem2, d3oeem3, d3oeen1, d3oeen2, d3oeen3, d3oeeo1, d3oeeo2, d3oeeo3, d3oeep_, d3oeev1, d3oeev2, d3oeev3, d3oeew1, d3oeew2, d3oeew3, d3oeex1, d3oeex2, d3oeex3, d3oeey_ |