![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) ![]() |
![]() | Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
![]() | Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [88893] (14 PDB entries) Uniprot P19483 |
![]() | Domain d1e1qc1: 1e1q C:380-510 [18295] Other proteins in same PDB: d1e1qa2, d1e1qa3, d1e1qb2, d1e1qb3, d1e1qc2, d1e1qc3, d1e1qd1, d1e1qd2, d1e1qd3, d1e1qe1, d1e1qe2, d1e1qe3, d1e1qf1, d1e1qf2, d1e1qf3, d1e1qg_ complexed with adp, anp, mg, po4 |
PDB Entry: 1e1q (more details), 2.61 Å
SCOPe Domain Sequences for d1e1qc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e1qc1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke ivtnflagfea
Timeline for d1e1qc1: