Lineage for d3ob9b_ (3ob9 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785217Family b.34.13.0: automated matches [191621] (1 protein)
    not a true family
  6. 2785218Protein automated matches [191139] (6 species)
    not a true protein
  7. 2785231Species Human (Homo sapiens) [TaxId:9606] [189257] (7 PDB entries)
  8. 2785240Domain d3ob9b_: 3ob9 B: [182910]
    Other proteins in same PDB: d3ob9d2
    automated match to d2efia1
    complexed with nhe, so4

Details for d3ob9b_

PDB Entry: 3ob9 (more details), 2.5 Å

PDB Description: Structure of the human MSL3 chromo-barrel domain at 2.5 Angstrom resolution
PDB Compounds: (B:) Male-specific lethal 3-like 1 (Drosophila), isoform CRA_c

SCOPe Domain Sequences for d3ob9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ob9b_ b.34.13.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmkfkfhsgekvlcfepdptkarvlydakivdvivgkdekgrkipeylihfngwnrswdr
waaedhvlrdtdenrrlqrklarkava

SCOPe Domain Coordinates for d3ob9b_:

Click to download the PDB-style file with coordinates for d3ob9b_.
(The format of our PDB-style files is described here.)

Timeline for d3ob9b_: