Lineage for d3ob9a_ (3ob9 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 947418Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 947564Family b.34.13.0: automated matches [191621] (1 protein)
    not a true family
  6. 947565Protein automated matches [191139] (2 species)
    not a true protein
  7. 947569Species Human (Homo sapiens) [TaxId:9606] [189257] (5 PDB entries)
  8. 947581Domain d3ob9a_: 3ob9 A: [182909]
    automated match to d2efia1
    complexed with nhe, so4

Details for d3ob9a_

PDB Entry: 3ob9 (more details), 2.5 Å

PDB Description: Structure of the human MSL3 chromo-barrel domain at 2.5 Angstrom resolution
PDB Compounds: (A:) Male-specific lethal 3-like 1 (Drosophila), isoform CRA_c

SCOPe Domain Sequences for d3ob9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ob9a_ b.34.13.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egmkfkfhsgekvlcfepdptkarvlydakivdvivgkdekgrkipeylihfngwnrswd
rwaaedhvlrdtdenrrlqrklarkavar

SCOPe Domain Coordinates for d3ob9a_:

Click to download the PDB-style file with coordinates for d3ob9a_.
(The format of our PDB-style files is described here.)

Timeline for d3ob9a_: