Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (6 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (182 PDB entries) Uniprot P01887 |
Domain d3o9wb_: 3o9w B: [182900] Other proteins in same PDB: d3o9wa1, d3o9wa2, d3o9wc1, d3o9wc2, d3o9wd1, d3o9wd2 automated match to d1p4lb_ complexed with 1o2, nag |
PDB Entry: 3o9w (more details), 2.8 Å
SCOPe Domain Sequences for d3o9wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o9wb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} qktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdws fyilahteftptetdtyacrvkhasmaepktvywdrd
Timeline for d3o9wb_: