Lineage for d3o6ob_ (3o6o B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537078Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2537320Protein automated matches [190229] (12 species)
    not a true protein
  7. 2537493Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189431] (2 PDB entries)
  8. 2537495Domain d3o6ob_: 3o6o B: [182840]
    Other proteins in same PDB: d3o6oa2
    automated match to d1uy6a_
    complexed with 1pe, 94m

Details for d3o6ob_

PDB Entry: 3o6o (more details), 2 Å

PDB Description: crystal structure of the n-terminal domain of an hsp90 from trypanosoma brucei, tb10.26.1080 in the presence of an the inhibitor biib021
PDB Compounds: (B:) Heat shock protein 83

SCOPe Domain Sequences for d3o6ob_:

Sequence, based on SEQRES records: (download)

>d3o6ob_ d.122.1.1 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdeph
lrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqfg
vgfysaylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedqq
eyleerrlkdlikkhsefigydielmv

Sequence, based on observed residues (ATOM records): (download)

>d3o6ob_ d.122.1.1 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdeph
lrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqfg
vgfysaylvadrvtvvsknneddaytwessaggtftvtstpdlkrgtrivlhlkedqqey
leerrlkdlikkhsefigydielmv

SCOPe Domain Coordinates for d3o6ob_:

Click to download the PDB-style file with coordinates for d3o6ob_.
(The format of our PDB-style files is described here.)

Timeline for d3o6ob_: