SCOPe 2.06: Domain d3o5zb_: 3o5z B:

Lineage for d3o5zb_ (3o5z B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (90 PDB entries)

8. Domain d3o5zb_: 3o5z B: [182818]
   automated match to d1pnja_
   complexed with cl, mpd

Details for d3o5zb_

PDB Entry: 3o5z, 2.01 Å

PDB Description: Crystal structure of the SH3 domain from p85beta subunit of phosphoinositide 3-kinase (PI3K)

PDB Compounds: (B:) Phosphatidylinositol 3-kinase regulatory subunit beta

SCOPe Domain Sequences for d3o5zb_:

Sequence; same for both SEQRES and ATOM records:

>d3o5zb_ b.34.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egfqyralypfrrerpedlellpgdvlvvsraalqalgvaeggercpqsvgwmpglnert
rqrgdfpgtyveflgpva

Timeline for d3o5zb_:

• d3o5zb_ first appeared in SCOPe 2.01
  
• d3o5zb_ appears in SCOPe 2.05
  
• d3o5zb_ appears in SCOPe 2.07
  
• d3o5zb_ appears in the current release, SCOPe 2.08