Lineage for d1bmfa1 (1bmf A:380-510)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445008Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 445009Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 445010Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 445011Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)
  7. 445014Species Cow (Bos taurus) [TaxId:9913] [88893] (12 PDB entries)
  8. 445030Domain d1bmfa1: 1bmf A:380-510 [18281]
    Other proteins in same PDB: d1bmfa2, d1bmfa3, d1bmfb2, d1bmfb3, d1bmfc2, d1bmfc3, d1bmfd1, d1bmfd2, d1bmfd3, d1bmfe1, d1bmfe2, d1bmfe3, d1bmff1, d1bmff2, d1bmff3, d1bmfg_

Details for d1bmfa1

PDB Entry: 1bmf (more details), 2.85 Å

PDB Description: bovine mitochondrial f1-atpase

SCOP Domain Sequences for d1bmfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmfa1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOP Domain Coordinates for d1bmfa1:

Click to download the PDB-style file with coordinates for d1bmfa1.
(The format of our PDB-style files is described here.)

Timeline for d1bmfa1: