Lineage for d1e1rf1 (1e1r F:358-474)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154205Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
  4. 154206Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 154207Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 154208Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)
  7. 154212Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)
  8. 154230Domain d1e1rf1: 1e1r F:358-474 [18280]
    Other proteins in same PDB: d1e1ra2, d1e1ra3, d1e1rb2, d1e1rb3, d1e1rc2, d1e1rc3, d1e1rd2, d1e1rd3, d1e1re2, d1e1re3, d1e1rf2, d1e1rf3, d1e1rg_

Details for d1e1rf1

PDB Entry: 1e1r (more details), 2.5 Å

PDB Description: bovine mitochondrial f1-atpase inhibited by mg2+adp and aluminium fluoride

SCOP Domain Sequences for d1e1rf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1rf1 a.69.1.1 (F:358-474) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOP Domain Coordinates for d1e1rf1:

Click to download the PDB-style file with coordinates for d1e1rf1.
(The format of our PDB-style files is described here.)

Timeline for d1e1rf1: