Lineage for d1e1re1 (1e1r E:358-474)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282945Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 282946Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 282947Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 282987Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 282990Species Cow (Bos taurus) [TaxId:9913] [88929] (10 PDB entries)
  8. 282998Domain d1e1re1: 1e1r E:358-474 [18279]
    Other proteins in same PDB: d1e1ra1, d1e1ra2, d1e1ra3, d1e1rb1, d1e1rb2, d1e1rb3, d1e1rc1, d1e1rc2, d1e1rc3, d1e1rd2, d1e1rd3, d1e1re2, d1e1re3, d1e1rf2, d1e1rf3, d1e1rg_

Details for d1e1re1

PDB Entry: 1e1r (more details), 2.5 Å

PDB Description: bovine mitochondrial f1-atpase inhibited by mg2+adp and aluminium fluoride

SCOP Domain Sequences for d1e1re1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1re1 a.69.1.1 (E:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOP Domain Coordinates for d1e1re1:

Click to download the PDB-style file with coordinates for d1e1re1.
(The format of our PDB-style files is described here.)

Timeline for d1e1re1: