Lineage for d1e1ra1 (1e1r A:380-510)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330430Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2330431Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2330432Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2330433Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species)
  7. 2330452Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries)
    Uniprot P19483
  8. 2330474Domain d1e1ra1: 1e1r A:380-510 [18275]
    Other proteins in same PDB: d1e1ra2, d1e1ra3, d1e1rb2, d1e1rb3, d1e1rc2, d1e1rc3, d1e1rd1, d1e1rd2, d1e1rd3, d1e1re1, d1e1re2, d1e1re3, d1e1rf1, d1e1rf2, d1e1rf3, d1e1rg_
    complexed with adp, af3, anp, mg, po4

Details for d1e1ra1

PDB Entry: 1e1r (more details), 2.5 Å

PDB Description: bovine mitochondrial f1-atpase inhibited by mg2+adp and aluminium fluoride
PDB Compounds: (A:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1e1ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1ra1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOPe Domain Coordinates for d1e1ra1:

Click to download the PDB-style file with coordinates for d1e1ra1.
(The format of our PDB-style files is described here.)

Timeline for d1e1ra1: