SCOP 1.63: Domain d1e79f1: 1e79 F:358-474

Lineage for d1e79f1 (1e79 F:358-474)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)

6. Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)

8. Domain d1e79f1: 1e79 F:358-474 [18274]
   Other proteins in same PDB: d1e79a2, d1e79a3, d1e79b2, d1e79b3, d1e79c2, d1e79c3, d1e79d2, d1e79d3, d1e79e2, d1e79e3, d1e79f2, d1e79f3, d1e79g_, d1e79h1, d1e79h2, d1e79i_
   complexed with adp, atp, cry, glh, mg, so4

Details for d1e79f1

PDB Entry: 1e79, 2.4 Å

PDB Description: Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide)

SCOP Domain Sequences for d1e79f1:

Sequence; same for both SEQRES and ATOM records:

>d1e79f1 a.69.1.1 (F:358-474) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

Timeline for d1e79f1:

• d1e79f1 first appeared (with stable ids) in SCOP 1.55
  
• d1e79f1 appears in SCOP 1.61
  
• d1e79f1 appears in SCOP 1.65
  
• d1e79f1 appears in the current release, SCOPe 2.08