Lineage for d1e79e1 (1e79 E:358-474)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154205Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
  4. 154206Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 154207Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 154208Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (4 species)
  7. 154212Species Cow (Bos taurus) [TaxId:9913] [47920] (9 PDB entries)
  8. 154217Domain d1e79e1: 1e79 E:358-474 [18273]
    Other proteins in same PDB: d1e79a2, d1e79a3, d1e79b2, d1e79b3, d1e79c2, d1e79c3, d1e79d2, d1e79d3, d1e79e2, d1e79e3, d1e79f2, d1e79f3, d1e79g_, d1e79h1, d1e79h2, d1e79i_

Details for d1e79e1

PDB Entry: 1e79 (more details), 2.4 Å

PDB Description: Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide)

SCOP Domain Sequences for d1e79e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e79e1 a.69.1.1 (E:358-474) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOP Domain Coordinates for d1e79e1:

Click to download the PDB-style file with coordinates for d1e79e1.
(The format of our PDB-style files is described here.)

Timeline for d1e79e1: