SCOPe 2.03: Domain d3o0ge_: 3o0g E:

Lineage for d3o0ge_ (3o0g E:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein CDK5 activator 1 (NCK5a, p25) [74739] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74740] (5 PDB entries)
   Uniprot Q15078 145-294

8. Domain d3o0ge_: 3o0g E: [182723]
   Other proteins in same PDB: d3o0ga_, d3o0gb_
   automated match to d1ungd_
   complexed with 3o0

Details for d3o0ge_

PDB Entry: 3o0g, 1.95 Å

PDB Description: crystal structure of cdk5:p25 in complex with an atp analogue

PDB Compounds: (E:) Cyclin-dependent kinase 5 activator 1

SCOPe Domain Sequences for d3o0ge_:

Sequence; same for both SEQRES and ATOM records:

>d3o0ge_ a.74.1.1 (E:) CDK5 activator 1 (NCK5a, p25) {Human (Homo sapiens) [TaxId: 9606]}
qastsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvfl
ymlcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsv
inlmsskmlqinadphyftqvfsdlknes

Timeline for d3o0ge_:

• d3o0ge_ first appeared in SCOPe 2.01
  
• d3o0ge_ appears in SCOPe 2.02
  
• d3o0ge_ appears in SCOPe 2.04
  
• d3o0ge_ appears in the current release, SCOPe 2.08