Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Cyclin-dependent PK, CDK5 [88857] (1 species) CMGC group; CDKs subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [88858] (5 PDB entries) Uniprot Q00535 |
Domain d3o0ga_: 3o0g A: [182720] Other proteins in same PDB: d3o0gd_, d3o0ge_ automated match to d1unga_ complexed with 3o0 |
PDB Entry: 3o0g (more details), 1.95 Å
SCOPe Domain Sequences for d3o0ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o0ga_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr nvlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklys tsidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdf
Timeline for d3o0ga_: