Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Yarrowia lipolytica [TaxId:4952] [189520] (2 PDB entries) |
Domain d3o0dc_: 3o0d C: [182715] automated match to d1dt3a_ complexed with k, mpd, mrd, nag |
PDB Entry: 3o0d (more details), 1.7 Å
SCOPe Domain Sequences for d3o0dc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o0dc_ c.69.1.0 (C:) automated matches {Yarrowia lipolytica [TaxId: 4952]} vytstetshidqesynffekyarlanigycvgpgtkifkpfncglqcahfpnvelieefh dprlifdvsgylavdhaskqiylvirgthsledvitdirimqapltnfdlaanisstatc ddclvhngfiqsynntynqigpkldsvieqypdyqiavtghslggaaallfginlkvngh dplvvtlgqpivgnagfanwvdklffgqenpdvskvskdrklyrithrgdivpqvpfwdg yqhcsgevfidwplihpplsnvvmcqgqsnkqcsagntllqqvnvignhlqyfvtegvcg i
Timeline for d3o0dc_: