Lineage for d3nzxq_ (3nzx Q:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599542Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2599639Domain d3nzxq_: 3nzx Q: [182707]
    Other proteins in same PDB: d3nzx1_, d3nzxa_, d3nzxe_, d3nzxf_, d3nzxi_, d3nzxj_, d3nzxm_, d3nzxo_, d3nzxs_, d3nzxt_, d3nzxw_, d3nzxx_
    automated match to d1g65c_

Details for d3nzxq_

PDB Entry: 3nzx (more details), 2.7 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with ligand 2c
PDB Compounds: (Q:) Proteasome component PRE6

SCOPe Domain Sequences for d3nzxq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzxq_ d.153.1.4 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
q

SCOPe Domain Coordinates for d3nzxq_:

Click to download the PDB-style file with coordinates for d3nzxq_.
(The format of our PDB-style files is described here.)

Timeline for d3nzxq_: