Lineage for d3nzws_ (3nzw S:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988641Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2988657Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (240 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2988715Domain d3nzws_: 3nzw S: [182690]
    Other proteins in same PDB: d3nzw1_, d3nzw2_, d3nzwb_, d3nzwc1, d3nzwc2, d3nzwd_, d3nzwf_, d3nzwg_, d3nzwh_, d3nzwi_, d3nzwj_, d3nzwk_, d3nzwl_, d3nzwm_, d3nzwn_, d3nzwp_, d3nzwq1, d3nzwq2, d3nzwr_, d3nzwt_, d3nzwu_, d3nzwv_, d3nzww_, d3nzwx_, d3nzwy_, d3nzwz_
    automated match to d1g65e_
    complexed with mes

Details for d3nzws_

PDB Entry: 3nzw (more details), 2.5 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with 2b
PDB Compounds: (S:) Proteasome component PRE5

SCOPe Domain Sequences for d3nzws_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzws_ d.153.1.4 (S:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
frnnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqk
kiikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntq
syggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfik
idgnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d3nzws_:

Click to download the PDB-style file with coordinates for d3nzws_.
(The format of our PDB-style files is described here.)

Timeline for d3nzws_: