Lineage for d3nzwi_ (3nzw I:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2990986Protein Proteasome beta subunit (catalytic) [56252] (7 species)
  7. 2990995Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2991072Domain d3nzwi_: 3nzw I: [182683]
    Other proteins in same PDB: d3nzw2_, d3nzwa_, d3nzwb_, d3nzwc1, d3nzwc2, d3nzwd_, d3nzwe_, d3nzwf_, d3nzwg_, d3nzwh_, d3nzwk_, d3nzwl_, d3nzwn_, d3nzwo_, d3nzwp_, d3nzwq1, d3nzwq2, d3nzwr_, d3nzws_, d3nzwt_, d3nzwu_, d3nzwv_, d3nzwy_, d3nzwz_
    automated match to d1g0ui_
    complexed with mes

Details for d3nzwi_

PDB Entry: 3nzw (more details), 2.5 Å

PDB Description: Crystal structure of the yeast 20S proteasome in complex with 2b
PDB Compounds: (I:) Proteasome component PUP3

SCOPe Domain Sequences for d3nzwi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzwi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

SCOPe Domain Coordinates for d3nzwi_:

Click to download the PDB-style file with coordinates for d3nzwi_.
(The format of our PDB-style files is described here.)

Timeline for d3nzwi_: