Lineage for d1bqba1 (1bqb A:155-301)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4694Fold a.67: Thermolysin-like metalloproteases, C-terminal domain [47900] (1 superfamily)
  4. 4695Superfamily a.67.1: Thermolysin-like metalloproteases, C-terminal domain [47901] (1 family) (S)
  5. 4696Family a.67.1.1: Thermolysin-like metalloproteases, C-terminal domain [47902] (4 proteins)
  6. 4697Protein Aureolysin [47909] (1 species)
  7. 4698Species Staphylococcus aureus [TaxId:1280] [47910] (1 PDB entry)
  8. 4699Domain d1bqba1: 1bqb A:155-301 [18267]
    Other proteins in same PDB: d1bqba2

Details for d1bqba1

PDB Entry: 1bqb (more details), 1.72 Å

PDB Description: aureolysin, staphylococcus aureus metalloproteinase

SCOP Domain Sequences for d1bqba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqba1 a.67.1.1 (A:155-301) Aureolysin {Staphylococcus aureus}
anleykdqsgalnesfsdvfgyfvddedflmgedvytpgkegdalrsmsnpeqfgqpshm
kdyvytekdnggvhtnsgipnkaaynviqaigkskseqiyyralteyltsnsnfkdlkda
lyqaakdlyeqqtaeqvyeawnevgve

SCOP Domain Coordinates for d1bqba1:

Click to download the PDB-style file with coordinates for d1bqba1.
(The format of our PDB-style files is described here.)

Timeline for d1bqba1:

  • d1bqba1 does not appear in SCOP 1.57

View in 3D
Domains from same chain:
(mouse over for more information)
d1bqba2