Lineage for d3nzjl_ (3nzj L:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228415Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2228428Domain d3nzjl_: 3nzj L: [182667]
    Other proteins in same PDB: d3nzj1_, d3nzja_, d3nzje_, d3nzjf_, d3nzji_, d3nzjj_, d3nzjm_, d3nzjo_, d3nzjs_, d3nzjt_, d3nzjw_, d3nzjx_
    automated match to d1g0ul_
    complexed with mes

Details for d3nzjl_

PDB Entry: 3nzj (more details), 2.4 Å

PDB Description: Crystal structure of yeast 20S proteasome in complex with ligand 2a
PDB Compounds: (L:) Proteasome component C5

SCOPe Domain Sequences for d3nzjl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzjl_ d.153.1.4 (L:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOPe Domain Coordinates for d3nzjl_:

Click to download the PDB-style file with coordinates for d3nzjl_.
(The format of our PDB-style files is described here.)

Timeline for d3nzjl_: