Lineage for d1esp_1 (1esp 157-317)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4694Fold a.67: Thermolysin-like metalloproteases, C-terminal domain [47900] (1 superfamily)
  4. 4695Superfamily a.67.1: Thermolysin-like metalloproteases, C-terminal domain [47901] (1 family) (S)
  5. 4696Family a.67.1.1: Thermolysin-like metalloproteases, C-terminal domain [47902] (4 proteins)
  6. 4703Protein Neutral protease [47907] (1 species)
  7. 4704Species Bacillus cereus, strain dsm 3101 [TaxId:1396] [47908] (2 PDB entries)
  8. 4706Domain d1esp_1: 1esp 157-317 [18266]
    Other proteins in same PDB: d1esp_2

Details for d1esp_1

PDB Entry: 1esp (more details), 2.8 Å

PDB Description: neutral protease mutant e144s

SCOP Domain Sequences for d1esp_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esp_1 a.67.1.1 (157-317) Neutral protease {Bacillus cereus, strain dsm 3101}
iyqnesgalneaisdifgtlvefydnrnpdweigediytpgkagdalrsmsdptkygdpd
hyskrytgssdnggvhtnsgiinkqayllanggthygvtvtgigkdklgaiyyrantqyf
tqsttfsqaragavqaaadlygansaevaavkqsfsavgvn

SCOP Domain Coordinates for d1esp_1:

Click to download the PDB-style file with coordinates for d1esp_1.
(The format of our PDB-style files is described here.)

Timeline for d1esp_1:

  • d1esp_1 does not appear in SCOP 1.57

View in 3D
Domains from same chain:
(mouse over for more information)
d1esp_2