Lineage for d3nzj2_ (3nzj 2:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2552691Protein automated matches [190144] (11 species)
    not a true protein
  7. 2552712Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2552716Domain d3nzj2_: 3nzj 2: [182659]
    Other proteins in same PDB: d3nzj1_, d3nzja_, d3nzje_, d3nzjf_, d3nzji_, d3nzjj_, d3nzjm_, d3nzjo_, d3nzjs_, d3nzjt_, d3nzjw_, d3nzjx_
    automated match to d1ryph_
    complexed with mes

Details for d3nzj2_

PDB Entry: 3nzj (more details), 2.4 Å

PDB Description: Crystal structure of yeast 20S proteasome in complex with ligand 2a
PDB Compounds: (2:) Proteasome component PRE3

SCOPe Domain Sequences for d3nzj2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nzj2_ d.153.1.4 (2:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

SCOPe Domain Coordinates for d3nzj2_:

Click to download the PDB-style file with coordinates for d3nzj2_.
(The format of our PDB-style files is described here.)

Timeline for d3nzj2_: