Lineage for d3nyka_ (3nyk A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770922Protein Pseudoazurin [49522] (4 species)
  7. 2770950Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49523] (14 PDB entries)
    Uniprot P04377
  8. 2770952Domain d3nyka_: 3nyk A: [182630]
    automated match to d2p80d1
    complexed with co

Details for d3nyka_

PDB Entry: 3nyk (more details), 1.86 Å

PDB Description: The structure of cobalt-substituted pseudoazurin from Alcaligenes faecalis
PDB Compounds: (A:) pseudoazurin

SCOPe Domain Sequences for d3nyka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nyka_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia

SCOPe Domain Coordinates for d3nyka_:

Click to download the PDB-style file with coordinates for d3nyka_.
(The format of our PDB-style files is described here.)

Timeline for d3nyka_: