SCOPe 2.06: Domain d3ny6a1: 3ny6 A:427-629

Lineage for d3ny6a1 (3ny6 A:427-629)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (9 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [189511] (11 PDB entries)

8. Domain d3ny6a1: 3ny6 A:427-629 [182624]
   Other proteins in same PDB: d3ny6a2
   automated match to d1aerb_
   complexed with gol, po4, v30

Details for d3ny6a1

PDB Entry: 3ny6, 1.68 Å

PDB Description: catalytic fragment of cholix toxin from vibrio cholerae in complex with inhibitor v30

PDB Compounds: (A:) Cholix toxin

SCOPe Domain Sequences for d3ny6a1:

Sequence, based on SEQRES records:

>d3ny6a1 d.166.1.0 (A:427-629) automated matches {Vibrio cholerae [TaxId: 666]}
avitpqgvtnwtyqeleathqaltregyvfvgyhgtnhvaaqtivnriapvprgnntene
ekwgglyvathaevahgyarikegtgeyglptraerdargvmlrvyipraslerfyrtnt
plenaeehitqvighslplrneaftgpesaggedetvigwdmaihavaipstipgnayee
laideeavakeqsistkppyker

Sequence, based on observed residues (ATOM records):

>d3ny6a1 d.166.1.0 (A:427-629) automated matches {Vibrio cholerae [TaxId: 666]}
avitpqgvtnwtyqeleathqaltregyvfvgyhgtnhvaaqtivnriapvneekwggly
vathaevahgyarikegtgeyglptraerdargvmlrvyipraslerfyrtntplenaee
hitqvighslplrneaftgpesaggedetvigwdmaihavaipstipgnayeelaideea
vakeqsistkppyker

Timeline for d3ny6a1:

• d3ny6a1 first appeared in SCOPe 2.01, called d3ny6a_
  
• d3ny6a1 was called d3ny6a_ in SCOPe 2.05
  
• d3ny6a1 appears in SCOPe 2.07
  
• d3ny6a1 appears in the current release, SCOPe 2.08