SCOPe 2.05: Domain d3ny6a_: 3ny6 A:

Lineage for d3ny6a_ (3ny6 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (7 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [189511] (11 PDB entries)

8. Domain d3ny6a_: 3ny6 A: [182624]
   automated match to d1aerb_
   complexed with gol, po4, v30

Details for d3ny6a_

PDB Entry: 3ny6, 1.68 Å

PDB Description: catalytic fragment of cholix toxin from vibrio cholerae in complex with inhibitor v30

PDB Compounds: (A:) Cholix toxin

SCOPe Domain Sequences for d3ny6a_:

Sequence, based on SEQRES records:

>d3ny6a_ d.166.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
hmavitpqgvtnwtyqeleathqaltregyvfvgyhgtnhvaaqtivnriapvprgnnte
neekwgglyvathaevahgyarikegtgeyglptraerdargvmlrvyipraslerfyrt
ntplenaeehitqvighslplrneaftgpesaggedetvigwdmaihavaipstipgnay
eelaideeavakeqsistkppyker

Sequence, based on observed residues (ATOM records):

>d3ny6a_ d.166.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
hmavitpqgvtnwtyqeleathqaltregyvfvgyhgtnhvaaqtivnriapvneekwgg
lyvathaevahgyarikegtgeyglptraerdargvmlrvyipraslerfyrtntplena
eehitqvighslplrneaftgpesaggedetvigwdmaihavaipstipgnayeelaide
eavakeqsistkppyker

Timeline for d3ny6a_:

• d3ny6a_ first appeared in SCOPe 2.01
  
• d3ny6a_ appears in SCOPe 2.04
  
• d3ny6a_ is called d3ny6a1 in SCOPe 2.06
  
• d3ny6a_ appears in the current release, SCOPe 2.08, called d3ny6a1