Lineage for d3ny5b_ (3ny5 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1638517Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1638518Protein automated matches [190233] (10 species)
    not a true protein
  7. 1638535Species Human (Homo sapiens) [TaxId:9606] [187090] (41 PDB entries)
  8. 1638545Domain d3ny5b_: 3ny5 B: [182621]
    automated match to d1rfaa_

Details for d3ny5b_

PDB Entry: 3ny5 (more details), 1.99 Å

PDB Description: crystal structure of the rbd domain of serine/threonine-protein kinase b-raf from homo sapiens. northeast structural genomics consortium target hr4694f
PDB Compounds: (B:) Serine/threonine-protein kinase B-raf

SCOPe Domain Sequences for d3ny5b_:

Sequence, based on SEQRES records: (download)

>d3ny5b_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqdgekkpig
wdtdiswltgeelhvevlenvpltth

Sequence, based on observed residues (ATOM records): (download)

>d3ny5b_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqekkpigwd
tdiswltgeelhvevlenvpltth

SCOPe Domain Coordinates for d3ny5b_:

Click to download the PDB-style file with coordinates for d3ny5b_.
(The format of our PDB-style files is described here.)

Timeline for d3ny5b_: