Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187090] (3 PDB entries) |
Domain d3ny5b_: 3ny5 B: [182621] automated match to d1rfaa_ |
PDB Entry: 3ny5 (more details), 1.99 Å
SCOPe Domain Sequences for d3ny5b_:
Sequence, based on SEQRES records: (download)
>d3ny5b_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} shmqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqdgekkpig wdtdiswltgeelhvevlenvpltth
>d3ny5b_ d.15.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} shmqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqekkpigwd tdiswltgeelhvevlenvpltth
Timeline for d3ny5b_: