Lineage for d3ny5a_ (3ny5 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1017615Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1017616Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1018301Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1018302Protein automated matches [190233] (4 species)
    not a true protein
  7. 1018306Species Human (Homo sapiens) [TaxId:9606] [187090] (3 PDB entries)
  8. 1018309Domain d3ny5a_: 3ny5 A: [182620]
    automated match to d1rfaa_

Details for d3ny5a_

PDB Entry: 3ny5 (more details), 1.99 Å

PDB Description: crystal structure of the rbd domain of serine/threonine-protein kinase b-raf from homo sapiens. northeast structural genomics consortium target hr4694f
PDB Compounds: (A:) Serine/threonine-protein kinase B-raf

SCOPe Domain Sequences for d3ny5a_:

Sequence, based on SEQRES records: (download)

>d3ny5a_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqdgekkpigw
dtdiswltgeelhvevlenvplt

Sequence, based on observed residues (ATOM records): (download)

>d3ny5a_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqkkpigwdtd
iswltgeelhvevlenvplt

SCOPe Domain Coordinates for d3ny5a_:

Click to download the PDB-style file with coordinates for d3ny5a_.
(The format of our PDB-style files is described here.)

Timeline for d3ny5a_: