SCOPe 2.01: Domain d3nwva_: 3nwv A:

Lineage for d3nwva_ (3nwv A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109644] (2 PDB entries)
   Uniprot P99999

8. Domain d3nwva_: 3nwv A: [182593]
   automated match to d1j3sa_
   complexed with hem

Details for d3nwva_

PDB Entry: 3nwv, 1.9 Å

PDB Description: human cytochrome c g41s

PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d3nwva_:

Sequence; same for both SEQRES and ATOM records:

>d3nwva_ a.3.1.1 (A:) Mitochondrial cytochrome c {Human (Homo sapiens) [TaxId: 9606]}
gdvekgkkifimkcsqchtvekggkhktgpnlhglfgrktsqapgysytaanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

Timeline for d3nwva_:

• d3nwva_ is new in SCOPe 2.01-stable
  
• d3nwva_ appears in SCOPe 2.02
  
• d3nwva_ appears in the current release, SCOPe 2.08